PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A09G2437
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family Trihelix
Protein Properties Length: 288aa    MW: 34651.8 Da    PI: 7.665
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A09G2437genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix77.32.4e-2442124186
     trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                  +W+ qe+++ + +r e+++++ ++k++k lWe +s +mre+gf+rs +qCk+kw+nl +ryk ++++e++     ++++p++++l+
  Gh_A09G2437  42 QWSIQETKEFLMIRAELDRSFMETKRNKLLWEVISTRMREKGFNRSTEQCKCKWKNLVTRYKGCETMEEEA---MRQQFPFYNELQ 124
                  7********************************************************************95...56689*****98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd122031.39E-2141106No hitNo description
PfamPF138377.1E-2042126No hitNo description
PROSITE profilePS500907.3174399IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MEGHQHHHHQ YQQQQYQYHQ QQQQQQQPPT SSVNVDADRF PQWSIQETKE FLMIRAELDR  60
SFMETKRNKL LWEVISTRMR EKGFNRSTEQ CKCKWKNLVT RYKGCETMEE EAMRQQFPFY  120
NELQAIFSAR MQSILWSESE GGATGSKRKA VQLSSDEEED TEEKELEKSS VRKKKQGKTS  180
GGAGIGGSTS GNGNNSNNIK EILEDFMRQQ MQMEMQWREA FEAREHERRL KEMEWRQKME  240
ALENERILMD RRWYEREEQR RMREEARAEK RDALITALLN KLRRDDHM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ebi_A2e-1239122386DNA binding protein GT-1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00481DAPTransfer from AT5G01380Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN1277681e-72JN127768.1 Theobroma cacao clone TCC_BC011L18, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012486231.11e-149PREDICTED: trihelix transcription factor GT-3b
SwissprotQ9SDW05e-75TGT3A_ARATH; Trihelix transcription factor GT-3a
TrEMBLA0A0D2QCA71e-149A0A0D2QCA7_G
STRINGPOPTR_0006s10240.11e-114(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22152870
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G01380.16e-54Trihelix family protein